PDB entry 1dp2

View 1dp2 on RCSB PDB site
Description: crystal structure of the complex between rhodanese and lipoate
Deposited on 1999-12-23, released 2000-12-13
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-13, with a file datestamp of 2000-12-13.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.17
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dp2A (A:)
    vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
    eecrdkaspyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfgh
    rtvsvlnggfrnwlkeghpvtsepsrpepaifkatlnrsllktyeqvlenleskrfqlvd
    sraqgrylgtqpepdavgldsghirgsvnmpfmnfltedgfekspeelramfeakkvdlt
    kpliatcrkgvtachialaaylcgkpdvaiydgswfewfhrappetwvsqgkg