PDB entry 1dp0

View 1dp0 on RCSB PDB site
Description: e. coli beta-galactosidase at 1.7 angstrom
Class: hydrolase
Keywords: tim barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase
Deposited on 1999-12-22, released 2001-02-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.158
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dp0A (A:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dp0A (A:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dp0B (B:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dp0B (B:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dp0C (C:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dp0C (C:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dp0D (D:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dp0D (D:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk