PDB entry 1doz

View 1doz on RCSB PDB site
Description: crystal structure of ferrochelatase
Class: lyase
Keywords: rossmann fold, pi-helix, lyase
Deposited on 1999-12-22, released 2000-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1doza_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dozA (A:)
    srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
    qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs
    vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
    ahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
    lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
    tvvlkklgr