PDB entry 1doy

View 1doy on RCSB PDB site
Description: 1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
Deposited on 1995-09-14, released 1996-03-08
The last revision prior to the SCOP 1.63 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: NMR3
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1doy__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1doy_ (-)
    asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
    qsfldddqieagyvltcvayptsdctiethkeedly