PDB entry 1dox

View 1dox on RCSB PDB site
Description: 1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
Class: electron transport
Keywords: iron-sulfur protein
Deposited on 1995-09-14, released 1996-03-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR3
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin [2fe-2s]
    Species: Synechocystis sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1doxa_
  • Heterogens: FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1doxA (A:)
    asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
    qsfldddqieagyvltcvayptsdctiethkeedly