PDB entry 1dow

View 1dow on RCSB PDB site
Description: crystal structure of a chimera of beta-catenin and alpha-catenin
Class: cell adhesion
Keywords: four-helix bundle, CELL ADHESION
Deposited on 1999-12-21, released 2000-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: -1.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-catenin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26231 (0-204)
      • modified residue (47)
      • modified residue (67)
      • modified residue (87)
      • modified residue (133)
      • modified residue (150)
    Domains in SCOPe 2.07: d1dowa_
  • Chain 'B':
    Compound: beta-catenin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02248 (0-31)
      • modified residue (13)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dowA (A:)
    kahvlaasveqatenflekgdkiakesqflkeelvvavedvrkqgdlmksaagefaddpc
    ssvkrgnmvraarallsavtrlliladmadvykllvqlkvvedgilklrnagneqdlgiq
    ykalkpevdklnimaakrqqelkdvgnrdqmaaargilqknvpilytasqaclqhpdvaa
    ykanrdliykqlqqavtgisnaaqa
    

  • Chain 'B':
    No sequence available.