PDB entry 1dov

View 1dov on RCSB PDB site
Description: crystal structure of the alpha-catenin dimerization domain
Class: cell adhesion
Keywords: four-helix bundle, CELL ADHESION
Deposited on 1999-12-21, released 2000-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-catenin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dova_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dovA (A:)
esqflkeelvvavedvrkqgdlmksaagefaddpcssvkrgnmvraarallsavtrllil
admadvykllvqlkvvedgilklrnagneqdlgiqykalkpevdklnimaakrqqelkdv
gnrdqmaaargilqknvpilytasqaclqhpdvaaykanrdliykqlqqavtgisnaaqa
t