PDB entry 1dot

View 1dot on RCSB PDB site
Description: crystallographic structure of duck ovotransferrin at 2.3 angstroms resolution
Deposited on 1995-08-03, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.23
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dot_ (-)
    appkttvrwctissaeekkcnslkdhmqqervtlscvqkatyldcikaisnneadaisld
    ggqvfeaglapyklkpiaaevyersggsttsyyavavvkkgtdfmikdlrgktschtglg
    rsagwnipigtlihrediewegiesgiseqavakffsascvpgatieqklcrqckgdakt
    kclrngpysgysgafqclkdgkgdvafvkhttvqenapeekdeyellcldgsrqpvdsyk
    tcnwarvaahavvarddskiddiwsflgmqayslgvdttsdfhlfgppgkkdpvlkdllf
    kdsaimlkrvpelmdsqlylgfeyysaiqslrkdqltvgprenkiqwcavgkdekskcdr
    wsvvsngevectilddnkdcivkitkgeadaisldggfvytagvcglvpvvgesyedetq
    cskdeeqpayyfavavvkkssaitwnnlqgkkschtavgrtagwnipmglihnktgscdf
    ddyfsegcapgsppnsrlcklcqgsgenllekcvasshekyygytgalrclveqgdvafi
    khstvgenvsgsnkddwakgltrddfellctngkraktmdyktchlakvpthavvarpek
    ankirellegqeklfglhgtekerfmmfqsqtkdllfkaltkclvklrqgitykeflgde
    yyasvaslntcnpsdllqvctfledk