PDB entry 1dot

View 1dot on RCSB PDB site
Description: crystallographic structure of duck ovotransferrin at 2.3 angstroms resolution
Class: iron transport protein
Keywords: iron transport protein
Deposited on 1995-08-03, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-07.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.23
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: duck ovotransferrin
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dota1, d1dota2
  • Heterogens: NAG, FUC, FE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dotA (A:)
    appkttvrwctissaeekkcnslkdhmqqervtlscvqkatyldcikaisnneadaisld
    ggqvfeaglapyklkpiaaevyersggsttsyyavavvkkgtdfmikdlrgktschtglg
    rsagwnipigtlihrediewegiesgiseqavakffsascvpgatieqklcrqckgdakt
    kclrngpysgysgafqclkdgkgdvafvkhttvqenapeekdeyellcldgsrqpvdsyk
    tcnwarvaahavvarddskiddiwsflgmqayslgvdttsdfhlfgppgkkdpvlkdllf
    kdsaimlkrvpelmdsqlylgfeyysaiqslrkdqltvgprenkiqwcavgkdekskcdr
    wsvvsngevectilddnkdcivkitkgeadaisldggfvytagvcglvpvvgesyedetq
    cskdeeqpayyfavavvkkssaitwnnlqgkkschtavgrtagwnipmglihnktgscdf
    ddyfsegcapgsppnsrlcklcqgsgenllekcvasshekyygytgalrclveqgdvafi
    khstvgenvsgsnkddwakgltrddfellctngkraktmdyktchlakvpthavvarpek
    ankirellegqeklfglhgtekerfmmfqsqtkdllfkaltkclvklrqgitykeflgde
    yyasvaslntcnpsdllqvctfledk