PDB entry 1dor

View 1dor on RCSB PDB site
Description: dihydroorotate dehydrogenase a from lactococcus lactis
Class: oxidoreductase
Keywords: oxidoreductase, pyrimidine nucleotide biosynthesis
Deposited on 1997-01-14, released 1997-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotate dehydrogenase a
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dora_
  • Chain 'B':
    Compound: dihydroorotate dehydrogenase a
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dorb_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dorA (A:)
    mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
    lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
    sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
    lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
    peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
    iadfhgklksl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dorB (B:)
    mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
    lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
    sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
    lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
    peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
    iadfhgklksl