PDB entry 1doo

View 1doo on RCSB PDB site
Description: heat shock locus v (hslv)-heat shock locus u (hslu) from e. coli
Class: chaperone
Keywords: hslvu, clpqy, aaa-ATPase, ATP-dependent proteolysis, proteasome
Deposited on 1999-12-21, released 2000-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2001-09-26, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.301
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (heat shock locus v)
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dooa_
  • Chain 'B':
    Compound: protein (heat shock locus v)
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1doob_
  • Chain 'C':
    Compound: protein (heat shock locus v)
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dooc_
  • Chain 'D':
    Compound: protein (heat shock locus v)
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dood_
  • Chain 'E':
    Compound: protein (heat shock locus u)
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dooe_
  • Chain 'F':
    Compound: protein (heat shock locus u)
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1doof_
  • Heterogens: ANP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dooA (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dooB (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dooC (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dooD (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1dooE (E:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
    mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
    daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
    ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
    egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
    adyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dooE (E:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklreglkikdamkllieeea
    aklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctv
    stkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnas
    itvqykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisyda
    sdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1dooF (F:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
    mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
    daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
    ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
    egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
    adyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dooF (F:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklreglkikdamkllieeea
    aklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctv
    stkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnas
    itvqykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisyda
    sdlsgqnitidadyvskhldalvadedlsrfil