PDB entry 1doj

View 1doj on RCSB PDB site
Description: crystal structure of human alpha-thrombin*rwj-51438 complex at 1.7 a
Deposited on 1999-12-21, released 2000-11-03
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-03, with a file datestamp of 2000-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.174
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1doja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dojA (A:)
    tfgsgeadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspq
    ellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismleki
    yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl
    ketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegd
    sggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dojA (A:)
    tfgsgeadcglrplfekksledkterellesyigivegsdaeigmspwqvmlfrkspqel
    lcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyi
    hprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlke
    twtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsg
    gpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge