PDB entry 1doj

View 1doj on RCSB PDB site
Description: Crystal structure of human alpha-thrombin*RWJ-51438 complex at 1.7 A
Class: hydrolase/hydrolase inhibitor
Keywords: thrombin, serine protease, enzyme inhibition, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 1999-12-21, released 2000-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.174
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1doja_
  • Chain 'B':
    Compound: hirugen
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 1Z0, NAG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dojA (A:)
    tfgsgeadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspq
    ellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismleki
    yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl
    ketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegd
    sggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dojA (A:)
    tfgsgeadcglrplfekksledkterellesyidivegsdaeigmspwqvmlfrkspqel
    lcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyi
    hprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlke
    twtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsg
    gpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
    

  • Chain 'B':
    No sequence available.