PDB entry 1dof

View 1dof on RCSB PDB site
Description: the crystal structure of adenylosuccinate lyase from pyrobaculum aerophilum: insights into thermal stability and human pathology
Deposited on 1999-12-20, released 2001-01-10
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.203
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dofa_
  • Chain 'B':
    Domains in SCOP 1.55: d1dofb_
  • Chain 'C':
    Domains in SCOP 1.55: d1dofc_
  • Chain 'D':
    Domains in SCOP 1.55: d1dofd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dofA (A:)
    hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
    evyrleretghdilslvllleqksgcryvhygatsndiidtawallirralaavkekara
    vgdqlasmarkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefiraki
    ggavgtmaswgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferla
    veirelsrpeigevveggggssamphkanptaserivslaryvralthvafenvalwher
    dltnsanervwipeallaldeiltsalrvlknvyideeritenlqkalpyiltefhmnrm
    ikegasraeaykkakevkaltfeyqkwpverliedalslklc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dofA (A:)
    hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
    evhdilslvllleqksgcryvhygatsndiidtawallirralaavkekaravgdqlasm
    arkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirakiggavgtma
    swgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferlaveirelsr
    peigevvegganptaserivslaryvralthvafenvalwherdltnsanervwipeall
    aldeiltsalrvlknvyideeritenlqkalpyiltefhmnrmikegasraeaykkakev
    kaltfeyqkwpverliedalslklc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dofB (B:)
    hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
    evyrleretghdilslvllleqksgcryvhygatsndiidtawallirralaavkekara
    vgdqlasmarkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefiraki
    ggavgtmaswgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferla
    veirelsrpeigevveggggssamphkanptaserivslaryvralthvafenvalwher
    dltnsanervwipeallaldeiltsalrvlknvyideeritenlqkalpyiltefhmnrm
    ikegasraeaykkakevkaltfeyqkwpverliedalslklc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dofB (B:)
    hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
    evhdilslvllleqksgcryvhygatsndiidtawallirralaavkekaravgdqlasm
    arkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirakiggavgtma
    swgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferlaveirelsr
    peigevvegganptaserivslaryvralthvafenvalwherdltnsanervwipeall
    aldeiltsalrvlknvyideeritenlqkalpyiltefhmnrmikegasraeaykkakev
    kaltfeyqkwpverliedalslklc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dofC (C:)
    hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
    evyrleretghdilslvllleqksgcryvhygatsndiidtawallirralaavkekara
    vgdqlasmarkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefiraki
    ggavgtmaswgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferla
    veirelsrpeigevveggggssamphkanptaserivslaryvralthvafenvalwher
    dltnsanervwipeallaldeiltsalrvlknvyideeritenlqkalpyiltefhmnrm
    ikegasraeaykkakevkaltfeyqkwpverliedalslklc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dofC (C:)
    hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
    evhdilslvllleqksgcryvhygatsndiidtawallirralaavkekaravgdqlasm
    arkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirakiggavgtma
    swgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferlaveirelsr
    peigevvegganptaserivslaryvralthvafenvalwherdltnsanervwipeall
    aldeiltsalrvlknvyideeritenlqkalpyiltefhmnrmikegasraeaykkakev
    kaltfeyqkwpverliedalslklc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dofD (D:)
    hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
    evyrleretghdilslvllleqksgcryvhygatsndiidtawallirralaavkekara
    vgdqlasmarkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefiraki
    ggavgtmaswgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferla
    veirelsrpeigevveggggssamphkanptaserivslaryvralthvafenvalwher
    dltnsanervwipeallaldeiltsalrvlknvyideeritenlqkalpyiltefhmnrm
    ikegasraeaykkakevkaltfeyqkwpverliedalslklc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dofD (D:)
    hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
    evhdilslvllleqksgcryvhygatsndiidtawallirralaavkekaravgdqlasm
    arkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirakiggavgtma
    swgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferlaveirelsr
    peigevvegganptaserivslaryvralthvafenvalwherdltnsanervwipeall
    aldeiltsalrvlknvyideeritenlqkalpyiltefhmnrmikegasraeaykkakev
    kaltfeyqkwpverliedalslklc