PDB entry 1doc

View 1doc on RCSB PDB site
Description: the mobil flavin of 4-oh benzoate hydroxylase: motion of a prosthetic group regulates catalysis
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1994-09-06, released 1994-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-hydroxybenzoate hydroxylase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1doca1, d1doca2
  • Heterogens: BR, FAD, PHB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1docA (A:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
    vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
    vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
    ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekvedwsderfw
    telkarlpsevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
    laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
    qriqqteleyylgseaglatiaenyvglpyeeie