PDB entry 1dob

View 1dob on RCSB PDB site
Description: the mobil flavin of 4-oh benzoate hydroxylase: motion of a prosthetic group regulates catalysis
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1994-09-06, released 1994-11-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-hydroxybenzoate hydroxylase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20586 (0-393)
      • conflict (221)
    Domains in SCOPe 2.05: d1doba1, d1doba2
  • Heterogens: FAD, PHB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dobA (A:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
    vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
    vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
    ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryfvqvplsekvedwsderfw
    telkarlpsevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
    laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
    qriqqteleyylgseaglatiaenyvglpyeeie