PDB entry 1doa

View 1doa on RCSB PDB site
Description: Structure of the rho family gtp-binding protein cdc42 in complex with the multifunctional regulator rhogdi
Class: cell cycle
Keywords: GTP-binding protein, Cdc42, RhoGDI, CELL CYCLE
Deposited on 1999-12-20, released 2000-02-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.257
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (GTP-binding protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (3-190)
      • see remark 999 (0-2)
      • modified residue (190)
    Domains in SCOPe 2.01: d1doaa_
  • Chain 'B':
    Compound: protein (GDP-dissociation inhibitor 1)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1doab_
  • Heterogens: MG, GDP, GER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1doaA (A:)
    gshmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfd
    tagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqi
    dlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
    eppepkksrrc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1doaB (B:)
    gspgisgggggilglmaeqeptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkdd
    eslrkykeallgrvavsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlk
    egveyrikisfrvnreivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeea
    pkgmlargsyniksrftdddrtdhlswewnltikkewkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1doaB (B:)
    eptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrvavsad
    pnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
    gmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdd
    drtdhlswewnltikkewkd