PDB entry 1do9

View 1do9 on RCSB PDB site
Description: solution structure of oxidized microsomal rabbit cytochrome b5. factors determining the heterogeneous binding of the heme.
Deposited on 1999-12-20, released 2000-01-05
The last revision prior to the SCOP 1.71 freeze date was dated 2000-03-20, with a file datestamp of 2000-03-20.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1do9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1do9A (A:)
    dkdvkyytleeikkhnhskstwlilhhkvydltkfleehpggeevlreqaggdatenfed
    vghstdarelsktfiigelhpddrsklskpmetl