PDB entry 1do9

View 1do9 on RCSB PDB site
Description: solution structure of oxidized microsomal rabbit cytochrome b5. factors determining the heterogeneous binding of the heme.
Class: electron transport
Keywords: cytochrome, heme, electron transport
Deposited on 1999-12-20, released 2000-01-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b5
  Species: Oryctolagus cuniculus [TaxId:9986]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00169 (0-93)
  Domains in SCOPe 2.08: d1do9a_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1do9A (A:)
  dkdvkyytleeikkhnhskstwlilhhkvydltkfleehpggeevlreqaggdatenfed
  vghstdarelsktfiigelhpddrsklskpmetl