PDB entry 1do8

View 1do8 on RCSB PDB site
Description: crystal structure of a closed form of human mitochondrial nad(p)+-dependent malic enzyme
Class: oxidoreductase
Keywords: Oxidative Decarboxylase, Four domains: one with Rossmann fold, one with parallel alpha-beta fold, one mostly helical, and one mostly extended, OXIDOREDUCTASE
Deposited on 1999-12-19, released 2000-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do8a1, d1do8a2
  • Chain 'B':
    Compound: malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do8b3, d1do8b4
  • Chain 'C':
    Compound: malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do8c3, d1do8c4
  • Chain 'D':
    Compound: malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do8d3, d1do8d4
  • Heterogens: OXL, MN, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1do8A (A:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewpesassppvite
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do8A (A:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1do8B (B:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewpesassppvite
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do8B (B:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1do8C (C:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewpesassppvite
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do8C (C:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1do8D (D:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewpesassppvite
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do8D (D:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewp