PDB entry 1do7

View 1do7 on RCSB PDB site
Description: carbonmonoxy-myoglobin (mutant l29w) rebinding structure after photolysis at t< 180k
Deposited on 1999-12-19, released 2000-01-05
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-02, with a file datestamp of 2000-04-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.186
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1do7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1do7A (A:)
    vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gnfgadaqgamnkalelfrkdiaakykelgyqg