PDB entry 1do6

View 1do6 on RCSB PDB site
Description: crystal structure of superoxide reductase in the oxidized state at 2.0 angstrom resolution
Class: oxidoreductase
Keywords: non-heme iron protein, immunoglobulin-like (ig) beta barrel fold, oxidoreductase
Deposited on 1999-12-19, released 2000-03-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide reductase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1do6a_
  • Chain 'B':
    Compound: superoxide reductase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1do6b_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1do6A (A:)
misetirsgdwkgekhvpvieyeregelvkvkvqvgkeiphpnttehhiryielyflpeg
enfvyqvgrveftahgesvngpntsdvytepiayfvlktkkkgklyalsycnihglwene
vtle

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1do6B (B:)
misetirsgdwkgekhvpvieyeregelvkvkvqvgkeiphpnttehhiryielyflpeg
enfvyqvgrveftahgesvngpntsdvytepiayfvlktkkkgklyalsycnihglwene
vtle