PDB entry 1do5

View 1do5 on RCSB PDB site
Description: human copper chaperone for superoxide dismutase domain II
Class: chaperone
Keywords: beta-barrel, chaperone
Deposited on 1999-12-18, released 2000-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.228
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human copper chaperone for superoxide dismutase domain II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do5a_
  • Chain 'B':
    Compound: human copper chaperone for superoxide dismutase domain II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do5b_
  • Chain 'C':
    Compound: human copper chaperone for superoxide dismutase domain II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do5c_
  • Chain 'D':
    Compound: human copper chaperone for superoxide dismutase domain II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do5d_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1do5A (A:)
    qnlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncns
    cgnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliideg
    eddlgrgghplskitgnsgerlacgiiarsaglf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1do5B (B:)
    qnlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncns
    cgnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliideg
    eddlgrgghplskitgnsgerlacgiiarsaglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do5B (B:)
    gaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnscgn
    hfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidegedd
    lgrgghplskitgnsgerlacgiiarsa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1do5C (C:)
    qnlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncns
    cgnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliideg
    eddlgrgghplskitgnsgerlacgiiarsaglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do5C (C:)
    gaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnscgn
    hfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidegedd
    lgrgghplskitgnsgerlacgiiarsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1do5D (D:)
    qnlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncns
    cgnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliideg
    eddlgrgghplskitgnsgerlacgiiarsaglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do5D (D:)
    nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
    gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
    ddlgrgghplskitgnsgerlacgiiarsaglf