PDB entry 1do2

View 1do2 on RCSB PDB site
Description: trigonal crystal form of heat shock locus u (hslu) from escherichia coli
Class: chaperone
Keywords: hslu, clpy, aaa-ATPase, ATP-dependent proteolysis, proteasome, chaperone
Deposited on 1999-12-18, released 2000-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.229
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (heat shock locus u)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do2a_
  • Chain 'B':
    Compound: protein (heat shock locus u)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do2b_
  • Chain 'C':
    Compound: protein (heat shock locus u)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do2c_
  • Chain 'D':
    Compound: protein (heat shock locus u)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do2d_
  • Heterogens: ANP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1do2A (A:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
    mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
    daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
    ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
    egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
    adyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do2A (A:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkarkl
    kikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsreg
    vqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalt
    tsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrlh
    tvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1do2B (B:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
    mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
    daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
    ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
    egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
    adyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do2B (B:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkarkl
    kikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsreg
    vqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalt
    tsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrlh
    tvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1do2C (C:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
    mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
    daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
    ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
    egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
    adyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do2C (C:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkarkl
    kikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsreg
    vqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalt
    tsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrlh
    tvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1do2D (D:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
    mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
    daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
    ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
    egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
    adyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do2D (D:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkarkl
    kikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsreg
    vqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalt
    tsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrlh
    tvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil