PDB entry 1do0

View 1do0 on RCSB PDB site
Description: orthorhombic crystal form of heat shock locus u (hslu) from escherichia coli
Class: chaperone
Keywords: hslu, clpy, aaa-ATPase, ATP-dependent proteolysis, ATPase, proteasome, chaperone
Deposited on 1999-12-18, released 2000-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.294
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (heat shock locus u)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do0a_
  • Chain 'B':
    Compound: protein (heat shock locus u)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do0b_
  • Chain 'C':
    Compound: protein (heat shock locus u)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do0c_
  • Chain 'D':
    Compound: protein (heat shock locus u)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do0d_
  • Chain 'E':
    Compound: protein (heat shock locus u)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do0e_
  • Chain 'F':
    Compound: protein (heat shock locus u)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1do0f_
  • Heterogens: SO4, MG, ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1do0A (A:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
    mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
    daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
    ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
    egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
    adyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do0A (A:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidarklk
    ikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregv
    qrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqaltt
    sdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrlht
    vlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1do0B (B:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
    mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
    daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
    ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
    egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
    adyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do0B (B:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidarklk
    ikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregv
    qrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqaltt
    sdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrlht
    vlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1do0C (C:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
    mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
    daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
    ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
    egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
    adyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do0C (C:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidarklk
    ikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregv
    qrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqaltt
    sdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrlht
    vlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1do0D (D:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
    mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
    daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
    ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
    egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
    adyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do0D (D:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidarklk
    ikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregv
    qrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqaltt
    sdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrlht
    vlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1do0E (E:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
    mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
    daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
    ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
    egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
    adyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do0E (E:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidarklk
    ikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregv
    qrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqaltt
    sdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrlht
    vlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1do0F (F:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
    mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
    daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
    ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
    egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
    adyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1do0F (F:)
    semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
    raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidarklk
    ikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregv
    qrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqaltt
    sdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrlht
    vlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil