PDB entry 1dny

View 1dny on RCSB PDB site
Description: solution structure of pcp, a prototype for the peptidyl carrier domains of modular peptide synthetases
Class: ligase
Keywords: FOUR-HELIX BUNDLE, MODULAR ENZYME, DOMAIN, FLEXIBLE REGION, 4'-PHOSPHOPANTETHEINYL COFACTOR, modular peptide synthetases, nonribosomal peptide synthesis, peptidyl carrier protein (PCP), LIGASE
Deposited on 1999-12-17, released 2000-05-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-ribosomal peptide synthetase peptidyl carrier protein
    Species: Brevibacillus brevis [TaxId:1393]
    Gene: TYCC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1dnya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1dnyA (A:)
mpvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq
velplkvlfaqptikalaqyvatrshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1dnyA (A:)
yvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyqvelplkv
lfaqptikalaqyvat