PDB entry 1dny

View 1dny on RCSB PDB site
Description: solution structure of pcp, a prototype for the peptidyl carrier domains of modular peptide synthetases
Class: ligase
Keywords: FOUR-HELIX BUNDLE, MODULAR ENZYME, DOMAIN, FLEXIBLE REGION, 4'-PHOSPHOPANTETHEINYL COFACTOR, modular peptide synthetases, nonribosomal peptide synthesis, peptidyl carrier protein (PCP)
Deposited on 1999-12-17, released 2000-05-17
The last revision prior to the SCOP 1.73 freeze date was dated 2000-05-17, with a file datestamp of 2007-06-04.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-ribosomal peptide synthetase peptidyl carrier protein
    Species: Brevibacillus brevis
    Gene: TYCC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dnya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dnyA (A:)
    mpvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq
    velplkvlfaqptikalaqyvatrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dnyA (A:)
    yvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyqvelplkv
    lfaqptikalaqyvat