PDB entry 1dny

View 1dny on RCSB PDB site
Description: solution structure of pcp, a prototype for the peptidyl carrier domains of modular peptide synthetases
Deposited on 1999-12-17, released 2000-05-17
The last revision prior to the SCOP 1.57 freeze date was dated 2000-05-17, with a file datestamp of 2000-05-17.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1dnya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dnyA (A:)
    yvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyqvelplkv
    lfaqptikalaqyvat