PDB entry 1dnw

View 1dnw on RCSB PDB site
Description: human myeloperoxidase-cyanide-thiocyanate complex
Deposited on 1999-12-16, released 2001-12-21
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-21, with a file datestamp of 2001-12-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1dnw.1
  • Chain 'B':
    Domains in SCOP 1.59: d1dnw.2
  • Chain 'C':
    Domains in SCOP 1.59: d1dnw.1
  • Chain 'D':
    Domains in SCOP 1.59: d1dnw.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dnwA (A:)
    cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
    aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dnwB (B:)
    cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
    aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dnwC (C:)
    vncetscvqqppcfplkippndpriknqadcipffrscpacpgsnitirnqinaltsfvd
    asmvygseeplarnlrnmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripc
    flagdtrssempeltsmhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiit
    yrdylplvlgptamrkylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqp
    mepnprvplsrvffaswrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmr
    igldlpalnmqrsrdhglpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpn
    nidiwmggvseplkrkgrvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqis
    lpriicdntgittvsknnifmsnsyprdfvncstlpalnlaswrea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dnwD (D:)
    vncetscvqqppcfplkippndpriknqadcipffrscpacpgsnitirnqinaltsfvd
    asmvygseeplarnlrnmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripc
    flagdtrssempeltsmhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiit
    yrdylplvlgptamrkylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqp
    mepnprvplsrvffaswrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmr
    igldlpalnmqrsrdhglpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpn
    nidiwmggvseplkrkgrvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqis
    lpriicdntgittvsknnifmsnsyprdfvncstlpalnlaswrea