PDB entry 1dnp

View 1dnp on RCSB PDB site
Description: structure of deoxyribodipyrimidine photolyase
Deposited on 1995-07-03, released 1996-08-01
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.172
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dnpA (A:)
    tthlvwfrqdlrlhdnlalaaacrnssarvlalyiatprqwathnmsprqaelinaqlng
    lqialaekgipllfrevddfvasveivkqvcaensvthlfynyqyevnerardveveral
    rnvvcegfddsvilppgavmtgnhemykvftpfknawlkrlregmpecvaapkvrssgsi
    epspsitlnyprqsfdtahfpveekaaiaqlrqfcqngageyeqqrdfpavegtsrlsas
    latgglsprqclhrllaeqpqaldggagsvwlneliwrefyrhlityhpslckhrpfiaw
    tdrvqwqsnpahlqawqegktgypivdaamrqlnstgwmhnrlrmitasflvkdllidwr
    egeryfmsqlidgdlaannggwqwaastgtdaapyfrifnpttqgekfdhegefirqwlp
    elrdvpgkvvhepwkwaqkagvtldypqpivehkearvqtlaayeaark
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dnpB (B:)
    tthlvwfrqdlrlhdnlalaaacrnssarvlalyiatprqwathnmsprqaelinaqlng
    lqialaekgipllfrevddfvasveivkqvcaensvthlfynyqyevnerardveveral
    rnvvcegfddsvilppgavmtgnhemykvftpfknawlkrlregmpecvaapkvrssgsi
    epspsitlnyprqsfdtahfpveekaaiaqlrqfcqngageyeqqrdfpavegtsrlsas
    latgglsprqclhrllaeqpqaldggagsvwlneliwrefyrhlityhpslckhrpfiaw
    tdrvqwqsnpahlqawqegktgypivdaamrqlnstgwmhnrlrmitasflvkdllidwr
    egeryfmsqlidgdlaannggwqwaastgtdaapyfrifnpttqgekfdhegefirqwlp
    elrdvpgkvvhepwkwaqkagvtldypqpivehkearvqtlaayeaark