PDB entry 1dnl

View 1dnl on RCSB PDB site
Description: x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution
Class: oxidoreductase
Keywords: beta barrel, protein-fmn complex, oxidoreductase
Deposited on 1999-12-16, released 2000-01-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyridoxine 5'-phosphate oxidase
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28225 (0-198)
      • modified residue (33)
      • modified residue (59)
      • modified residue (93)
      • modified residue (107)
    Domains in SCOPe 2.06: d1dnla_
  • Heterogens: PO4, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dnlA (A:)
gglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivllkhydekgm
vfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkyfhsrprdsqi
gawvskqssrisargileskflelkqkfqqgevplpsfwggfrvsleqiefwqggehrlh
drflyqrendawkidrlap