PDB entry 1dnl

View 1dnl on RCSB PDB site
Description: x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution
Class: oxidoreductase
Keywords: beta barrel, protein-fmn complex, oxidoreductase
Deposited on 1999-12-16, released 2000-01-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pyridoxine 5'-phosphate oxidase
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P28225 (0-198)
    • modified residue (33)
    • modified residue (59)
    • modified residue (93)
    • modified residue (107)
  Domains in SCOPe 2.08: d1dnla_
• Heterogens: PO4, FMN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dnlA (A:)
  gglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivllkhydekgm
  vfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkyfhsrprdsqi
  gawvskqssrisargileskflelkqkfqqgevplpsfwggfrvsleqiefwqggehrlh
  drflyqrendawkidrlap