PDB entry 1dnk

View 1dnk on RCSB PDB site
Description: the x-ray structure of the dnase i-d(ggtatacc)2 complex at 2.3 angstroms resolution
Deposited on 1992-08-10, released 1994-01-31
The last revision prior to the SCOP 1.67 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1dnka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dnkA (A:)
    lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
    ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
    hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
    wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
    lsnemalaisdhypvevtlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dnkA (A:)
    lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
    ntyhyvvseplgrnsykerylflfrpnkvsvldtyqysfsrepavvkfsshstkvkefai
    valhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssqwssirlrtss
    tfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayglsnemalais
    dhypvevtlt