PDB entry 1dmz

View 1dmz on RCSB PDB site
Description: a refined nmr structure of a new phophopeptide-binding domain containing the fha2 of rad53
Class: transferase
Keywords: beta-sandwich, antiparallel beta-sheets, transferase
Deposited on 1999-12-15, released 2000-01-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (protein kinase spk1)
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22216 (0-157)
  Domains in SCOPe 2.01: d1dmza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dmzA (A:)
  gngrfltlkplpdsiiqesleiqqgvnpffigrsedcnckiednrlsrvhcfifkkrhav
  gksmyespaqglddiwychtgtnvsylnnnrmiqgtkfllqdgdeikiiwdknnkfvigf
  kveindttglfneglgmlqeqrvvlkqtaeekdlvkkl