PDB entry 1dmw

View 1dmw on RCSB PDB site
Description: crystal structure of double truncated human phenylalanine hydroxylase with bound 7,8-dihydro-l-biopterin
Class: oxidoreductase
Keywords: iron enzyme, 7, 8-dihydro-l-biopterin, cofactor, oxidoreductase
Deposited on 1999-12-15, released 2000-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanine hydroxylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dmwa_
  • Heterogens: FE, HBI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dmwA (A:)
    vpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpiprv
    eymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqtc
    tgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsdr
    sfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqyc
    lsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydpy
    tqrievl