PDB entry 1dmt

View 1dmt on RCSB PDB site
Description: structure of human neutral endopeptidase complexed with phosphoramidon
Class: hydrolase
Keywords: hydrolase, metalloprotease, signal-anchor
Deposited on 1999-12-15, released 2000-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutral endopeptidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dmta_
  • Heterogens: NAG, ZN, RDF, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dmtA (A:)
    gickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdel
    evvlkdvlqepktedivavqkakalyrscinesaidsrggepllkllpdiygwpvatenw
    eqkygaswtaekaiaqlnskygkkvlinlfvgtddknsvnhvihidqprlglpsrdyyec
    tgiykeactayvdfmisvarlirqeerlpidenqlalemnkvmelekeianatakpedrn
    dpmllynkmtlaqiqnnfsleingkpfswlnftneimstvnisitneedvvvyapeyltk
    lkpiltkysardlqnlmswrfimdlvsslsrtykesrnafrkalygttsetatwrrcany
    vngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltwmdaetkkraeekal
    aikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkde
    wisgaavvnafyssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddng
    rnfnkdgdlvdwwtqqsasnfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngg
    lgqayrayqnyikkngeekllpgldlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhsp
    gnfriigtlqnsaefseafhcrknsymnpekkcrvw