PDB entry 1dmr

View 1dmr on RCSB PDB site
Description: oxidized dmso reductase from rhodobacter capsulatus
Deposited on 1997-04-22, released 1998-03-18
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.147
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dmr_ (-)
    langtvmsgshwgvftatvengrataftpwekdphpspmlagvldsiysptrikypmvrr
    eflekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrl
    hncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmv
    fwaadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgaehitpkpqt
    dvaimlgmahtlvaedlydkdfianytsgfdkflpyldgetdstpktaewaegisgvpae
    tikelarlfeskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysg
    ggtpstsgpalagitdggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskf
    pdvkmaywvggnpfvhhqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyern
    dietigdysntgilamkkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfy
    ddaakqgkaagvqmpafdafwaegivefpvtdgadfvryasfredpllnplgtptgliei
    yskniekmgyddcpahptwmeplerldgpgakyplhiaashpfnrlhsqlngtvlregya
    vqghepclmhpddaaargiadgdvvrvhndrgqiltgvkvtdavmkgviqiyeggwydps
    dvtepgtldkygdvnvlsadigtsklaqgncgqtvlaevekytgpavtltgfvapkaae