PDB entry 1dmr

View 1dmr on RCSB PDB site
Description: oxidized dmso reductase from rhodobacter capsulatus
Class: oxidoreductase
Keywords: oxidoreductase, reductase, dmso, molybdopterin
Deposited on 1997-04-22, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.147
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dmso reductase
    Species: Rhodobacter capsulatus [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52675 (Start-822)
      • differences in map (80)
      • differences in map (84)
      • conflict (148)
      • differences in map (275)
      • differences in map (277)
      • differences in map (321)
      • differences in map (335-336)
      • differences in map (353)
      • conflict (415)
      • differences in map (497)
      • conflict (567)
      • missing from gb (593)
      • conflict (596)
    Domains in SCOPe 2.07: d1dmra1, d1dmra2
  • Heterogens: PGD, 6MO, O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dmrA (A:)
    mtkfsgnelraelyrraflsysvapgalgmfgrsllakgaraealangtvmsgshwgvft
    atvengrataftpwekdphpspmlagvldsiysptrikypmvrreflekgvnadrstrgn
    gdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrlhncttllrrmltlagg
    yvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmvfwaadpiktsqigwvi
    pehgaypglealkakgtkvividpvrtktveffgaehitpkpqtdvaimlgmahtlvaed
    lydkdfianytsgfdkflpyldgetdstpktaewaegisgvpaetikelarlfeskrtml
    aagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysgggtpstsgpalagitd
    ggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskfpdvkmaywvggnpfvh
    hqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyerndietigdysntgilam
    kkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfyddaakqgkaagvqmpa
    fdafwaegivefpvtdgadfvryasfredpllnplgtptglieiyskniekmgyddcpah
    ptwmeplerldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaa
    rgiadgdvvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnv
    lsadigtsklaqgncgqtvlaevekytgpavtltgfvapkaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dmrA (A:)
    langtvmsgshwgvftatvengrataftpwekdphpspmlagvldsiysptrikypmvrr
    eflekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrl
    hncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmv
    fwaadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgaehitpkpqt
    dvaimlgmahtlvaedlydkdfianytsgfdkflpyldgetdstpktaewaegisgvpae
    tikelarlfeskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysg
    ggtpstsgpalagitdggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskf
    pdvkmaywvggnpfvhhqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyern
    dietigdysntgilamkkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfy
    ddaakqgkaagvqmpafdafwaegivefpvtdgadfvryasfredpllnplgtptgliei
    yskniekmgyddcpahptwmeplerldgpgakyplhiaashpfnrlhsqlngtvlregya
    vqghepclmhpddaaargiadgdvvrvhndrgqiltgvkvtdavmkgviqiyeggwydps
    dvtepgtldkygdvnvlsadigtsklaqgncgqtvlaevekytgpavtltgfvapkaae