PDB entry 1dmq

View 1dmq on RCSB PDB site
Description: crystal structure of mutant enzyme y32f of ketosteroid isomerase from pseudomonas putida biotype b
Class: isomerase
Keywords: coneshell, closed barrel, curved b-sheet, isomerase
Deposited on 1999-12-14, released 2000-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered (31)
    Domains in SCOPe 2.07: d1dmqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dmqA (A:)
    mnlptaqevqglmaryielvdvgdieaivqmfaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dmqA (A:)
    nlptaqevqglmaryielvdvgdieaivqmfaddatvedpfgqppihgreqiaafyrqgl
    kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
    lsv