PDB entry 1dmp

View 1dmp on RCSB PDB site
Description: structure of hiv-1 protease complex
Class: aspartyl proteinase
Keywords: aids, polyprotein, hydrolase, aspartyl protease, acid protease, RNA-directed DNA polymerase, endonuclease, aspartyl proteinase
Deposited on 1996-11-01, released 1997-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
    • modified residue (66)
    • conflict (94)
  Domains in SCOPe 2.08: d1dmpa_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
    • modified residue (66)
    • conflict (94)
  Domains in SCOPe 2.08: d1dmpb_
• Heterogens: DMQ

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dmpA (A:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dmpB (B:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigatlnf