PDB entry 1dml

View 1dml on RCSB PDB site
Description: crystal structure of herpes simplex ul42 bound to the c-terminus of hsv pol
Class: DNA binding protein/transferase
Keywords: herpes simplex virus, dna synthesis, sliding clamps, PCNA, processivity, DNA BINDING PROTEIN/TRANSFERASE COMPLEX
Deposited on 1999-12-14, released 2000-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase processivity factor
    Species: Human herpesvirus 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dmla1, d1dmla2
  • Chain 'B':
    Compound: DNA polymerase
    Species: Human herpesvirus 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA polymerase processivity factor
    Species: Human herpesvirus 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dmlc1, d1dmlc2
  • Chain 'D':
    Compound: DNA polymerase
    Species: Human herpesvirus 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: DNA polymerase processivity factor
    Species: Human herpesvirus 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dmle1, d1dmle2
  • Chain 'F':
    Compound: DNA polymerase
    Species: Human herpesvirus 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: DNA polymerase processivity factor
    Species: Human herpesvirus 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dmlg1, d1dmlg2
  • Chain 'H':
    Compound: DNA polymerase
    Species: Human herpesvirus 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dmlA (A:)
    mtdspggvapaspvedasdaslgqpeegapcqvvlqgaelngilqafaplrtslldsllv
    mgdrgilihntifgeqvflplehsqfsryrwrgptaaflslvdqkrsllsvfranqypdl
    rrvelaitgqapfrtlvqriwtttsdgeavelasetlmkreltsfvvlvpqgtpdvqlrl
    trpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareegvssststqvqils
    naltkagqaaanaktvygenthrtfsvvvddcsmravlrrlqvgggtlkfflttpvpslc
    vtatgpnavsavfllkpqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dmlA (A:)
    apcqvvlqgaelngilqafaplrtslldsllvmgdrgilihntifgeqvflplehsqfsr
    yrwrgptaaflslvdqkrsllsvfranqypdlrrvelaitgqapfrtlvqriwtttsdge
    avelasetlmkreltsfvvlvpqgtpdvqlrltrpqltkvlnatgadsatpttfelgvng
    kfsvfttstcvtfaareegnaktvygenthrtfsvvvddcsmravlrrlqvgggtlkffl
    ttpvpslcvtatgpnavsavfllkpqk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dmlC (C:)
    mtdspggvapaspvedasdaslgqpeegapcqvvlqgaelngilqafaplrtslldsllv
    mgdrgilihntifgeqvflplehsqfsryrwrgptaaflslvdqkrsllsvfranqypdl
    rrvelaitgqapfrtlvqriwtttsdgeavelasetlmkreltsfvvlvpqgtpdvqlrl
    trpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareegvssststqvqils
    naltkagqaaanaktvygenthrtfsvvvddcsmravlrrlqvgggtlkfflttpvpslc
    vtatgpnavsavfllkpqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dmlC (C:)
    apcqvvlqgaelngilqafaplrtslldsllvmgdrgilihntifgeqvflplehsqfsr
    yrwrgptaaflslvdqkrsllsvfranqypdlrrvelaitgqapfrtlvqriwtttsdge
    avelasetlmkreltsfvvlvpqgtpdvqlrltrpqltkvlnatgadsatpttfelgvng
    kfsvfttstcvtfaareeggqaaanaktvygenthrtfsvvvddcsmravlrrlqvgggt
    lkfflttpvpslcvtatgpnavsavfllkpqk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1dmlE (E:)
    mtdspggvapaspvedasdaslgqpeegapcqvvlqgaelngilqafaplrtslldsllv
    mgdrgilihntifgeqvflplehsqfsryrwrgptaaflslvdqkrsllsvfranqypdl
    rrvelaitgqapfrtlvqriwtttsdgeavelasetlmkreltsfvvlvpqgtpdvqlrl
    trpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareegvssststqvqils
    naltkagqaaanaktvygenthrtfsvvvddcsmravlrrlqvgggtlkfflttpvpslc
    vtatgpnavsavfllkpqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dmlE (E:)
    gapcqvvlqgaelngilqafaplrtslldsllvmgdrgilihntifgeqvflplehsqfs
    ryrwrgptaaflslvdqkrsllsvfranqypdlrrvelaitgqapfrtlvqriwtttsdg
    eavelasetlmkreltsfvvlvpqgtpdvqlrltrpqltkvlnatgadsatpttfelgvn
    gkfsvfttstcvtfaareegvssststnaktvygenthrtfsvvvddcsmravlrrlqvg
    ggtlkfflttpvpslcvtatgpnavsavfllkpqk
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1dmlG (G:)
    mtdspggvapaspvedasdaslgqpeegapcqvvlqgaelngilqafaplrtslldsllv
    mgdrgilihntifgeqvflplehsqfsryrwrgptaaflslvdqkrsllsvfranqypdl
    rrvelaitgqapfrtlvqriwtttsdgeavelasetlmkreltsfvvlvpqgtpdvqlrl
    trpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareegvssststqvqils
    naltkagqaaanaktvygenthrtfsvvvddcsmravlrrlqvgggtlkfflttpvpslc
    vtatgpnavsavfllkpqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dmlG (G:)
    gapcqvvlqgaelngilqafaplrtslldsllvmgdrgilihntifgeqvflplehsqfs
    ryrwrgptaaflslvdqkrsllsvfranqypdlrrvelaitgqapfrtlvqriwtttsdg
    eavelasetlmkreltsfvvlvpqgtpdvqlrltrpqltkvlnatgadsatpttfelgvn
    gkfsvfttstcvtfaareegvssststnaktvygenthrtfsvvvddcsmravlrrlqvg
    ggtlkfflttpvpslcvtatgpnavsavfllkpqk
    

  • Chain 'H':
    No sequence available.