PDB entry 1dmg

View 1dmg on RCSB PDB site
Description: crystal structure of ribosomal protein l4
Deposited on 1999-12-14, released 2000-12-18
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-18, with a file datestamp of 2000-12-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.208
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dmga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dmgA (A:)
    aqvdllnvkgekvgtleisdfvfnidpnydvmwryvdmqlsnrragtastktrgevsggg
    rkpwpqkhtgrarhgsirspiwrhggvvhgpkprdwskklnkkmkklalrsalsvkyren
    kllvlddlklerpktkslkeilqnlqlsdkktlivlpwkeegymnvklsgrnlpdvkvii
    adnpnnskngekavridglnvfdmlkydylvltrdmvskieevlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dmgA (A:)
    aqvdllnvkgekvgtleisdfvfnidpnydvmwryvdmqlsdwskklnkkmkklalrsal
    svkyrenkllvlddlklerpktkslkeilqnlqlsdkktlivlpwkeegymnvklsgrnl
    pdvkviiadnpnnskngekavridglnvfdmlkydylvltrdmvskieevlg