PDB entry 1dma

View 1dma on RCSB PDB site
Description: domain III of pseudomonas aeruginosa exotoxin complexed with nicotinamide and amp
Class: ADP-ribosylation
Keywords: ADP-ribosylation
Deposited on 1995-04-28, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dmaa_
  • Chain 'B':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dmab_
  • Heterogens: NCA, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dmaA (A:)
    flgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrars
    qdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltla
    apeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnvg
    gdldpssipdkeqaisalpdyasqpgkppredlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dmaA (A:)
    flgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvraai
    wrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltlaapeaag
    everlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnvggdldps
    sipdkeqaisalpdyasqpgkppr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dmaB (B:)
    flgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrars
    qdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltla
    apeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnvg
    gdldpssipdkeqaisalpdyasqpgkppredlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dmaB (B:)
    flgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrars
    qdldaiwrgfyiagdpalaygyaqirngallrvyvprsslpgfyrtsltlaapeaageve
    rlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnvdldpssipdk
    eqaisalpd