PDB entry 1dm5

View 1dm5 on RCSB PDB site
Description: annexin xii e105k homohexamer crystal structure
Class: unknown function
Keywords: homohexamer, novel ph-dependent hexamerization switch e76, low calcium form, mixed typeii/typeiii calcium binding site, e105k epsilon amino group replaces intermolecular calcium, unknown function
Deposited on 1999-12-13, released 2000-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin xii e105k mutant homohexamer
    Species: Hydra vulgaris [TaxId:6087]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26256 (0-314)
      • engineered mutation (103)
    Domains in SCOPe 2.08: d1dm5a_
  • Chain 'B':
    Compound: annexin xii e105k mutant homohexamer
    Species: Hydra vulgaris [TaxId:6087]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26256 (0-314)
      • engineered mutation (103)
    Domains in SCOPe 2.08: d1dm5b_
  • Chain 'C':
    Compound: annexin xii e105k mutant homohexamer
    Species: Hydra vulgaris [TaxId:6087]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26256 (0-314)
      • engineered mutation (103)
    Domains in SCOPe 2.08: d1dm5c_
  • Chain 'D':
    Compound: annexin xii e105k mutant homohexamer
    Species: Hydra vulgaris [TaxId:6087]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26256 (0-314)
      • engineered mutation (103)
    Domains in SCOPe 2.08: d1dm5d_
  • Chain 'E':
    Compound: annexin xii e105k mutant homohexamer
    Species: Hydra vulgaris [TaxId:6087]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26256 (0-314)
      • engineered mutation (103)
    Domains in SCOPe 2.08: d1dm5e_
  • Chain 'F':
    Compound: annexin xii e105k mutant homohexamer
    Species: Hydra vulgaris [TaxId:6087]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26256 (0-314)
      • engineered mutation (103)
    Domains in SCOPe 2.08: d1dm5f_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dm5A (A:)
    vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
    hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdknalidilctqsnaqih
    aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
    egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
    venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
    csgdykdlllqitgh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dm5B (B:)
    vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
    hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdknalidilctqsnaqih
    aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
    egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
    venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
    csgdykdlllqitgh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dm5C (C:)
    vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
    hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdknalidilctqsnaqih
    aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
    egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
    venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
    csgdykdlllqitgh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dm5D (D:)
    vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
    hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdknalidilctqsnaqih
    aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
    egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
    venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
    csgdykdlllqitgh
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dm5E (E:)
    vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
    hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdknalidilctqsnaqih
    aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
    egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
    venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
    csgdykdlllqitgh
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dm5F (F:)
    vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
    hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdknalidilctqsnaqih
    aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
    egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
    venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
    csgdykdlllqitgh