PDB entry 1dm4

View 1dm4 on RCSB PDB site
Description: ser195ala mutant of human thrombin complexed with fibrinopeptide a (7-16)
Class: hydrolase
Keywords: mutant thrombin, residual catalytic activity, fibrinopeptide a, hydrolase
Deposited on 1999-12-13, released 2000-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alpha thrombin:light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dm4.1
  • Chain 'B':
    Compound: protein (mutant alpha thrombin:heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (Start-259)
      • mutation (205)
    Domains in SCOPe 2.07: d1dm4.1
  • Chain 'C':
    Compound: protein (fibrinopeptide)
    Database cross-references and differences (RAF-indexed):
    • PDB 1DM4 (Start-9)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dm4A (A:)
    tfgsgeadcglrplfekksledkterellesyidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dm4A (A:)
    tfgsgeadcglrplfekksledkterellesyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dm4B (B:)
    rivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendl
    lvrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvc
    lpdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstri
    ritdnmfcagykpdegkrgdacegdaggpfvmkspfnnrwyqmgivswgegcdrdgkygf
    ythvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dm4B (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketgqpsvlqvvnlpiverpvckdstriritdnmfc
    agykpdegkrgdacegdaggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlk
    kwiqkvidqfge
    

  • Chain 'C':
    No sequence available.