PDB entry 1dm3

View 1dm3 on RCSB PDB site
Description: acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa
Class: transferase
Keywords: biosynthetic thiolase, reaction intermediate, acetyl-coa, beta-alpha fold, acetyl-coa acetyltransferase, transferase
Deposited on 1999-12-13, released 2001-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biosynthetic thiolase acetylated at cys89
    Species: ZOOGLOEA RAMIGERA [TaxId:350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07097 (0-388)
      • insertion (6)
      • modified residue (85)
      • conflict (125)
    Domains in SCOPe 2.07: d1dm3a1, d1dm3a2
  • Chain 'B':
    Compound: biosynthetic thiolase acetylated at cys89
    Species: ZOOGLOEA RAMIGERA [TaxId:350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07097 (0-388)
      • insertion (6)
      • modified residue (85)
      • conflict (125)
    Domains in SCOPe 2.07: d1dm3b1, d1dm3b2
  • Chain 'C':
    Compound: biosynthetic thiolase acetylated at cys89
    Species: ZOOGLOEA RAMIGERA [TaxId:350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07097 (0-388)
      • insertion (6)
      • modified residue (85)
      • conflict (125)
    Domains in SCOPe 2.07: d1dm3c1, d1dm3c2
  • Chain 'D':
    Compound: biosynthetic thiolase acetylated at cys89
    Species: ZOOGLOEA RAMIGERA [TaxId:350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07097 (0-388)
      • insertion (6)
      • modified residue (85)
      • conflict (125)
    Domains in SCOPe 2.07: d1dm3d1, d1dm3d2
  • Heterogens: SO4, ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dm3A (A:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dm3B (B:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dm3C (C:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dm3D (D:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl