PDB entry 1dm1

View 1dm1 on RCSB PDB site
Description: 2.0 a crystal structure of the double mutant h(e7)v, t(e10)r of myoglobin from aplysia limacina
Class: oxygen storage/transport
Keywords: globin fold
Deposited on 1999-12-13, released 2000-06-21
The last revision prior to the SCOP 1.73 freeze date was dated 2000-06-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.189
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Aplysia limacina
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02210 (0-145)
    • conflict (21)
    • engineered (62)
    • engineered (65)
    • conflict (79)
  Domains in SCOP 1.73: d1dm1a_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dm1A (A:)
  slsaaeadlagkswapvfanknangdaflvalfekfpdsanffadfkgksvadikaspkl
  rdhsstiftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
  appagadaawtklfgliidalkaagk