PDB entry 1dm1

View 1dm1 on RCSB PDB site
Description: 2.0 a crystal structure of the double mutant h(e7)v, t(e10)r of myoglobin from aplysia limacina
Class: oxygen storage/transport
Keywords: globin fold, oxygen storage/transport complex
Deposited on 1999-12-13, released 2000-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.189
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Aplysia limacina [TaxId:6502]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02210 (0-145)
      • conflict (21)
      • engineered (62)
      • engineered (65)
      • conflict (79)
    Domains in SCOPe 2.08: d1dm1a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dm1A (A:)
    slsaaeadlagkswapvfanknangdaflvalfekfpdsanffadfkgksvadikaspkl
    rdhsstiftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
    appagadaawtklfgliidalkaagk