PDB entry 1dly

View 1dly on RCSB PDB site
Description: x-ray crystal structure of hemoglobin from the green unicellular alga chlamydomonas eugametos
Class: oxygen storage/transport
Keywords: globin fold truncated hemoglobin, oxygen storage/transport complex
Deposited on 1999-12-13, released 2000-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin
    Species: Chlamydomonas eugametos [TaxId:3053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dlya_
  • Heterogens: CYN, SO4, HEM, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dlyA (A:)
    mmrtvqlrtlrpciraqqqpvrpstsataaaatapaparkcpsslfaklggreaveaavd
    kfynkivadptvstyfsntdmkvqrskqfaflayalggasewkgkdmrtahkdlvphlsd
    vhfqavarhlsdtltelgvppeditdamavvastrtevlnmpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dlyA (A:)
    slfaklggreaveaavdkfynkivadptvstyfsntdmkvqrskqfaflayalggasewk
    gkdmrtahkdlvphlsdvhfqavarhlsdtltelgvppeditdamavvastrtevlnmpq
    q