PDB entry 1dly

View 1dly on RCSB PDB site
Description: x-ray crystal structure of hemoglobin from the green unicellular alga chlamydomonas eugametos
Deposited on 1999-12-13, released 2000-09-20
The last revision prior to the SCOP 1.57 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1dlya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dlyA (A:)
  slfaklggreaveaavdkfynkivadptvstyfsntdmkvqrskqfaflayalggasewk
  gkdmrtahkdlvphlsdvhfqavarhlsdtltelgvppeditdamavvastrtevlnmpq
  q